For quotations, please use our online quotation form, and you may also contact us by
sales@neoscientific.com
+1-888.733.6849
+1-617.299.7367 (Int’l)
+1-888.733.6849
+1-617.299.7367 (Int’l)
Introduction | West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic complex of viruses. Image reconstructions and cryoelectron microscopyreveal a 45-50 nm virion covered with a relatively smooth proteinsurface. This structure is similar to virus; both belong to the genus flavivirus within the family Flaviviridae. WNV is a positive-sense, single strand of RNA, it is between 11,000 and 12,000 nucleotides long which encode seven non-structural proteins and three structural proteins. The RNA strand is held within a nucleocapsid formed from 12 kDaprotein blocks; the capsid is contained within a host-derived membrane altered by two viral glycoproteins. |
Synonyms | NULL |
Source | NULL |
Formulation | 20mM phosphate buffer pH 7.5. |
Stability | WNV Pre-M althoµgh stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles. |
Amino Acid Sequence | MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE. |
Purity | Protein is >95% pure as determined by SDS-PAGE. |
Usage | NeoScientific's products are furnished for LABORATORY RESEARCH USE ONLY.They may not be used as drµgs,agricultural or pesticidal products, food additives or household chemicals. |
Applications | Antigen in ELISA and Western blots, excellent antigen for detection of West-Nile virus with minimal specificity problems. |
Specificity | Immunoreactive with sera of West Nile virus infected individuals. |
N/A
N/A