Accelerate Your Biomolecule
and Bioassay Research
and Bioassay Research
sales@neoscientific.com
+1-888.733.6849
+1-617.299.7367 (Int’l)
+1-617.299.7367 (Int’l)
+1-888.733.6849
+1-617.299.7367 (Int’l)
+1-617.299.7367 (Int’l)
For quotations, please use our online quotation form, and you may also contact us by
sales@neoscientific.com
+1-888.733.6849
+1-617.299.7367 (Int’l)
+1-888.733.6849
+1-617.299.7367 (Int’l)
| Introduction | IL-12 is a heterodimeric cytokine that stimulates the production of interferon gamma from T-cells and natural killer cells, and also induces differentiation of Th1 helper cells. IL-12 is an initiator of cell-mediated immunity. |
| Synonyms | NKSF, CTL maturation factor (TCMF), Cytotoxic lymphocyte maturation factor (CLMF), TSF, Edodekin-alpha, IL-12. |
| Source | HEK. |
| Physical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation | The IL12 was lyophilized from 1mg/ml in 1xPBS. |
| Solubility | It is recommended to reconstitute the lyophilized IL12 in sterile PBS containing 0.1% endotoxin-free recombinant HSA. |
| Stability | Lyophilized IL-12 althoµgh stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL12 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Amino Acid Sequence | IL-12 is a heterodimer of IL-12A and IL-12B linked throµgh a disulfide-bond between cysteines in red in sequences below. >IL-12 ARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKL |
| Purity | Greater than 95% as obsereved by SDS-PAGE. |
| Biological Activity | The specific activity was determined by the dose-dependent release of IFN-gamma from the human NK92 cell line in presence of 20ng/mL rIL-2, and is typically 0.1-0.5ng/ml. |
| Usage | NeoScientifics products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drµgs, agricultural or pesticidal products, food additives or household chemicals. |
N/A
N/A
Copyrights © 2014 NEO Group 245 First Street, 18th Floor, Cambridge MA 02142 888.733.6849
