Inhibin a Human-Inhibin A

our services
our products
Quotations & Ordering:

For quotations, please use our online quotation form, and you may also contact us by

[email protected]

Phone:

+1-888.733.6849
+1-617.299.7367 (Int’l)
+44-203.695.3777 (UK)

Fax:

+1-888.733.6849
+1-617.299.7367 (Int’l)

Our customer service representatives are available 24 hours, Monday through Friday to assist you.

Inhibin a Human

Qty


Total
$65
Catalog #
HOPS-310
Size
Description
Inhibin-Alpha Human Recombinant produced in E.Coli is a non-glycosylated, polypeptide chain containing 264 amino acids comprising of both A and B chains, having a molecular mass of 33.5 kDa.The Inhibin-Alpha is fused with an amino-terminal hexahistidine tag. The Inhibin-Alpha is purified by standard chromatographic techniques.
Additional Information
IntroductionInhibins are dimeric peptide hormones produced by female ovarian granulose cells and male Sertoli cells as well as a variety of other tissues. Inhibins have two isoforms, A and B, with the same alpha subunit but different beta subunits. Inhibin A is a dimer of alpha and beta A subunits, inhibin B is a dimer of alpha and beta B subunits.Inhibins are thoµght to inhibit the production of follicle-stimulating hormone (FSH) by the pituitary gland. In addition, Inhibins are also thoµght to play a role in the control of gametogenesis, and embryonic and fetal development.
SynonymsNULL
SourceEscherichia Coli.
Physical AppearanceSterile Filtered clear solution.
FormulationInhibin-A alpha chain is supplied in 1x PBS and 50% glycerol.
StabilityStore at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.Please avoid freeze thaw cycles.
Amino Acid SequenceAlpha
chain:STPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIP
PNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI.Beta
Chain:GLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPSHIAGTSGSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDD
PurityGreater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
UsageNeoScientific's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drµgs, agricultural or pesticidal products, food additives or household chemicals.
Background

N/A

Protocol

N/A

MSDS
Reviews
Neo Scientific welcomes feedback from its customers.

If you have used an our product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information.

If you have any additional inquiries please email technical services at [email protected].

Thank you for your support.

promotions

Image

Custom Monoclonal Antibody
MassAb Technologies
Image
Free Trial Custom Polyclonal Antibody
You will receive free purified antibodies for validation
Image
Custom Peptides Synthesis

Start from $40/each

new technologies

Image
Optimized for enhanced
expression levels
XPromoter 2.0
Image
E.coli/insect cells/293 & CHO

3 in 1 expression system
Image
MassAb Technologies

Cover All Epitopes