PLA2G10 Human-Secreted Phospholipase A2

our services
our products
Quotations & Ordering:

For quotations, please use our online quotation form, and you may also contact us by

sales@neoscientific.com

Phone:

+1-888.733.6849
+1-617.299.7367 (Int’l)

Fax:

+1-888.733.6849
+1-617.299.7367 (Int’l)

Our customer service representatives are available 24 hours, Monday through Friday to assist you.

PLA2G10 Human

Qty


Total
$65
Catalog #
ENPS-336
Size
Description
Secreted Phospholipase A2-X Human Recombinant is manufactured with N-terminal fusion HisTag. PLA2G10 His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag (underlined).MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD.
Additional Information
IntroductionPhospholipase A2 (PLA2) catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to liberate arachidonic acid (AA), a precursor of eicosanoids including prostaglandins and leukotrienes. The same reaction also produces lysophosholipids, which represent another class of lipid mediators.The secretory PLA2 (sPLA2) family, in which 10 isozymes have been identified, consists of low molecular weight, Ca2+-requiring secretory enzymes that have been implicated in a number of biological processes, such as modification of eicosanoid generation, inflammation, and host defense.This enzyme has been proposed to hydrolyze phosphatidylcholine (PC) in lipoproteins to liberate lyso-PC and free fatty acids in the arterial wall, thereby facilitating the accumulation of bioactive lipids and modified lipoproteins in atherosclerotic foci.In mice, sPLA2 expression significantly influences HDL particle size and composition and demonstrate that an induction of sPLA2 is required for the decrease in plasma HDL cholesterol in response to inflammatory stimuli. Instillation of bacteria into the bronchi was associated with surfactant degradation and a decrease in large:small ratio of surfactant aggregates in rats.
SynonymsGroup 10 secretory phospholipase A2, EC 3.1.1.4, Group X secretory phospholipase A2, Phosphatidylcholine 2-acylhydrolase GX, GX sPLA2, sPLA2-X, SPLA2, GXPLA2, MGC119918, MGC119919, MGC133367, PLA2G10.
SourceEscherichia Coli.
Physical AppearanceSterile Filtered lyophilized (freeze-dried) powder.
FormulationSterile filtered and lyophilized from 0.5 mg/ml in 0.01M Tris buffer pH 7.2.
SolubilityAdd 0.2 ml of distilled water and let the lyophilized pellet dissolve completely.
StabilityStore lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.
PurityGreater than 95% as determined by SDS PAGE.
UsageNeoScientific's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drµgs, agricultural or pesticidal products, food additives or household chemicals.
Purification MethodSingle-step procedure using affinity Ni-NTA chromatography.
SpecificityThe amino acid sequence of the recombinant human Secreted Phospholipase A2-X is 100% homologous to the amino acid sequence of the human Secreted Phospholipase A2-X without signal sequence and activation peptide.
Background

N/A

Protocol

N/A

MSDS
Reviews
Neo Scientific welcomes feedback from its customers.

If you have used an our product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information.

If you have any additional inquiries please email technical services at info@neobiolab.com.

Thank you for your support.

promotions

Image

Custom Monoclonal Antibody
MassAb Technologies
Image
Free Trial Custom Polyclonal Antibody
You will receive free purified antibodies for validation
Image
Custom Peptides Synthesis

Start from $40/each

new technologies

Image
Optimized for enhanced
expression levels
XPromoter 2.0
Image
E.coli/insect cells/293 & CHO

3 in 1 expression system
Image
MassAb Technologies

Cover All Epitopes