OPG Fc Human-Osteoprotegerin

our services
our products
Quotations & Ordering:

For quotations, please use our online quotation form, and you may also contact us by

[email protected]

Phone:

+1-888.733.6849
+1-617.299.7367 (Int’l)
+44-203.695.3777 (UK)

Fax:

+1-888.733.6849
+1-617.299.7367 (Int’l)

Our customer service representatives are available 24 hours, Monday through Friday to assist you.

OPG Fc Human

Qty


Total
$65
Catalog #
CYPS-273
Size
Description
Recombinant OPG produced in yeast contains 412 amino acid residues, including 180 residues from mature OPG (a.a 22-201) and 232 residues from the Fc protein of human IgG1, and has a calculated molecular mass of 46.5 kDa. As a result of glycosylation, the recombinant Osteoprotegrin migrates as a 49 kDa protein in SDS-PAGE under reducing conditions.The OPG is purified by proprietary chromatographic techniques.
Additional Information
IntroductionOsteoprotegerin acts as decoy receptor for rankl and thereby neutralizes its function in osteoclastogenesis. OPG inhibits the activation of osteoclasts and promotes osteoclast apoptosis in vitro. Bone homeostasis seems to depend on the local rankl/opg ratio. Osteoprotegerin may also play a role in preventing arterial calcification. May act as decoy receptor for trail and protect against apoptosis. Trail binding blocks the inhibition of osteoclastogenesis.
SynonymsTNFRSF11B, OPG, OCIF, Osteoclastogenesis inhibitory factor, TR1, MGC29565.
SourcePichia Pastoris.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationOPG was lyophilized from a 0.2μm filtered concentrated (0.5mg/ml) solution in PBS, pH= 7.4.
SolubilityIt is recommended to reconstitute the lyophilized Osteoprotegerin in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
StabilityLyophilized Osteoprotegerin althoµgh stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution OCIF should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Amino Acid SequenceAA
Sequence:
OPG
22-201:
ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTL.
PurityGreater than 90.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Biological ActivityDetermined by its ability to neutralize the stimulation of U937 cells treated with 10ng/ml of soluble RANKL (sRANKL) corresponding to a Specific Activity of 100,000IU/mg.
UsageNeoScientific's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drµgs, agricultural or pesticidal products, food additives or household chemicals.
Background

N/A

Protocol

N/A

MSDS
Reviews
Neo Scientific welcomes feedback from its customers.

If you have used an our product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information.

If you have any additional inquiries please email technical services at [email protected].

Thank you for your support.

promotions

Image

Custom Monoclonal Antibody
MassAb Technologies
Image
Free Trial Custom Polyclonal Antibody
You will receive free purified antibodies for validation
Image
Custom Peptides Synthesis

Start from $40/each

new technologies

Image
Optimized for enhanced
expression levels
XPromoter 2.0
Image
E.coli/insect cells/293 & CHO

3 in 1 expression system
Image
MassAb Technologies

Cover All Epitopes