PROC Human-Coagulation Factors

our services
our products
Quotations & Ordering:

For quotations, please use our online quotation form, and you may also contact us by

[email protected]

Phone:

+1-888.733.6849
+1-617.299.7367 (Int’l)
+44-203.695.3777 (UK)

Fax:

+1-888.733.6849
+1-617.299.7367 (Int’l)

Our customer service representatives are available 24 hours, Monday through Friday to assist you.

PROC Human

Qty


Total
$65
Catalog #
PRPS-492
Size
Description
PROC Human Recombinant full length protein (33-461 aa) produced in HEK 293 cells with a C-terminal His-tag, having a molecular weight of 72kDa. Human PROC is purified by proprietary chromatographic techniques.
Additional Information
IntroductionProtein C (PROC) is a vitamin K-dependent serine protease which regulates blood coagulation by inactivating factors Va and VIIIa in the presence of calcium ions and phospholipids. PROC is cleaved to its activated form by the thrombin-thrombomodulin complex. This activated form, which contains a serine protease domain, functions in degradation of the activated forms of coagulation factors V and VIII. Mutations in the PROC gene are linked with thrombophilia due to protein C deficiency, neonatal purpura fulminans, and recurrent venous thrombosis. Protein C is synthesized as a single chain precursor, which is cleaved into a light and a heavy chain held together by a disulfide bond. The enzyme is at that time activated by thrombin, which cleaves a tetradecapeptide from the amino end of the heavy chain; this reaction, which occurs at the surface of endothelial cells, is intensely promoted by thrombomodulin.
SynonymsVitamin K-dependent protein C, Anticoagulant protein C, Autoprothrombin IIA, Blood coagulation factor XIV, PROC, PC, APC, PROC1, THPH3, THPH4.
SourceHEK 293 cells.
Physical AppearanceSterile Filtered clear solution.
FormulationPROC protein is supplied in 50mM Tris pH 7.5, 300mM NaCl and 10% Glycerol.
StabilityStore at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.
Amino Acid SequenceMWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERE
CIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIG
SFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGD
DLLQCHPAVKFPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPW
QVVLLDSKKKLACGAVLIHPSWVLTA
PurityGreater than 80.0% as determined by SDS-PAGE.
UsageNeoScientific's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drµgs, agricultural or pesticidal products, food additives or household chemicals.
Background

N/A

Protocol

N/A

MSDS
Reviews
Neo Scientific welcomes feedback from its customers.

If you have used an our product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information.

If you have any additional inquiries please email technical services at [email protected].

Thank you for your support.

promotions

Image

Custom Monoclonal Antibody
MassAb Technologies
Image
Free Trial Custom Polyclonal Antibody
You will receive free purified antibodies for validation
Image
Custom Peptides Synthesis

Start from $40/each

new technologies

Image
Optimized for enhanced
expression levels
XPromoter 2.0
Image
E.coli/insect cells/293 & CHO

3 in 1 expression system
Image
MassAb Technologies

Cover All Epitopes